PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G12730.1
Common NameMBK21.9, PHL12
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family G2-like
Protein Properties Length: 235aa    MW: 26928.7 Da    PI: 8.3496
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G12730.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like107.76.1e-342377155
      G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                 kprlrWt+eLHerFv+av++LGG+ekAtPkti+++m+vkgLtl+h+kSHLQk+Rl
  AT3G12730.1 23 KPRLRWTTELHERFVDAVTHLGGPEKATPKTIMRVMGVKGLTLYHLKSHLQKFRL 77
                 79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.5E-322078IPR009057Homeodomain-like
PROSITE profilePS5129411.812080IPR017930Myb domain
SuperFamilySSF466898.96E-172278IPR009057Homeodomain-like
TIGRFAMsTIGR015571.8E-242378IPR006447Myb domain, plants
PfamPF002494.9E-82575IPR001005SANT/Myb domain
PfamPF143795.3E-12124163IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 235 aa     Download sequence    Send to blast
MMQSREEIRD DSSSGLVLTT DPKPRLRWTT ELHERFVDAV THLGGPEKAT PKTIMRVMGV  60
KGLTLYHLKS HLQKFRLGKQ PHKEHSQNHS ICIRDTNRAS MLDLRRNAVF TTSPLIIGRN  120
MNEMQMEVQR RIEEEVVIER QVNQRIAAQG KYMESMLEKA CETQEASLTK DYSTLFFDRT  180
NICNNTSSIP IPWFEDHFPS SSSMDSTLIL PDINSNFSLQ DSRSSITKGR TVCLG
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.283300.0flower
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO306823040.0
Genevisible257698_at0.0
Expression AtlasAT3G12730-
AtGenExpressAT3G12730-
ATTED-IIAT3G12730-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in phloem and/or cambium. {ECO:0000269|PubMed:15923329}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00351DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G12730.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G12730
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0707640.0AY070764.1 Arabidopsis thaliana AT3g12730/MBK21_9 mRNA, complete cds.
GenBankAY1439160.0AY143916.1 Arabidopsis thaliana At3g12730/MBK21_9 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_187879.21e-177myb family transcription factor
SwissprotQ9SAK54e-70APL_ARATH; Myb family transcription factor APL
TrEMBLQ8VYI21e-177Q8VYI2_ARATH; AT3g12730/MBK21_9
STRINGAT3G12730.11e-177(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM137451726
Representative plantOGRP7817262
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Rubio V, et al.
    A conserved MYB transcription factor involved in phosphate starvation signaling both in vascular plants and in unicellular algae.
    Genes Dev., 2001. 15(16): p. 2122-33
    [PMID:11511543]
  3. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  4. Zhao C,Craig JC,Petzold HE,Dickerman AW,Beers EP
    The xylem and phloem transcriptomes from secondary tissues of the Arabidopsis root-hypocotyl.
    Plant Physiol., 2005. 138(2): p. 803-18
    [PMID:15923329]
  5. Causier B,Ashworth M,Guo W,Davies B
    The TOPLESS interactome: a framework for gene repression in Arabidopsis.
    Plant Physiol., 2012. 158(1): p. 423-38
    [PMID:22065421]